PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016448397.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 442aa    MW: 48467.5 Da    PI: 6.9784
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016448397.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding27.67e-095079131
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartm 31
                     r +WT+eE++++ +a k++G+  W+ I +++
   XP_016448397.1 50 REKWTEEEHKKFFEALKLYGSA-WRQIEEHV 79
                     789*******************.****9997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.97E-83881IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-54779IPR009057Homeodomain-like
PfamPF002495.5E-75079IPR001005SANT/Myb domain
CDDcd001671.83E-45286No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 442 aa     Download sequence    Send to blast
DQTKGVGQDA SSVISSKLGT VATQVKVETF PGNENMPKQV RKPYTFTKHR EKWTEEEHKK  60
FFEALKLYGS AWRQIEEHVA HDSGNDGDGS LNVMDIPPPR PKKKPLHPYP RKMVDSPITN  120
LGSSAQSERS PTPSASPQGR DTYSPDSVLC DSDLSGSPVA AQRSANLSPA SCKMDAHSDY  180
LISTENDAKY MTSKSSIEEE VPVASKVEAD SCWTSYQFQN GKFTIQASYR YQAVETPLAG  240
IKLFGQTVFV PDAPHLGSQG TENCNSLPSN ATEEKINIGN DNLFHSFPFN QANAQFILAM  300
VPGSTIPPAS XLPENWLDDN PNNLASLPAT MSWRSWYQGL VHRFVSPCSQ TATGSSVPSQ  360
RQNSKESQRE GSSSGSNIGS ASEADYGKRN CYAVESKCTS RSEKRNYIKG FVPYKRCLAE  420
RDGMSSGVGA EEREVQRARM CS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016448397.10.0PREDICTED: LOW QUALITY PROTEIN: protein CCA1-like, partial
TrEMBLM1CEP81e-132M1CEP8_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000658501e-131(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA74472127
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G17300.18e-20MYB_related family protein